Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VFLQQQCSPVVMPQR
Peptide within the protein Wheat-gluten-Q8H0J4:
SHIPGLERPWQQQPLPPQQTFPQQPPFSQQQQQQQQQPFPQQPSFSQQQPPFSQQQPILLQGPPFSQQTQPVLPQQSPFSQQQQLILPPQQQQQLPQQQISIVQPSILQQLNPCKVFLQQQCSPVVMPQRLARSQMWQQSSCHVMQQQCCQQLSQIPEQSRYDAIRAITYPIILQEQQQGFVQAQQQQPQQSDQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQVQQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFGVGTGVGAY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VFLQQQCSPVVMPQR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Triticum aestivum | Bread wheat | BAB78757 ACR10430 CAD58622 AGK83142 BAB78756 BAB78755 BAB78754 ACY08809 ACT98428 AGU91708 |
4565 |
| Triticum monococcum | Triticum monococcum | ACJ76968 ACJ76969 |
4568 |
| Triticum polonicum | Triticum polonicum | ABM91083 |
77606 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.