If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QQCCQQLAR
Peptide within the protein Wheat-gluten-Q94G98:
MKTLLILTIIAVALTTTTANIQVDPSGQVQWPQQQQPFPQPQQPFSQQPQQIFPQPQQTFPHQPQQAFPQPQQTFPHQPQQQFPQPQQPQQPFPQQPQQQFPQPQQPQQPFPQQPQQQFPQPQQPQQPFPQPQQPQLPFPQQPQQPFPQPQQPQQPFPQLQQPQQPLPQPQQPQQPFPQQQQPLIQPYLQQQMNPCKNYLLQQCNPVSLVSSLVSMILPRSDCKVMRQQCCQQLARIPQQL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QQCCQQLAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops comosa | Aegilops comosa | AFQ20168 AFQ20168 |
4485 |
| Triticum aestivum | Bread wheat | AAK84772 AAK84773 AAK84774 ADP95518 AAK84772 AAK84773 AAK84774 ADP95518 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ACI04104 ACI04104 |
488177 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.