Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DFEEPGHLAPTGLFLGGTK
Peptide within the protein Tri-a-12:
MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
References reporting this peptide:
- Šotkovský, et al. Proteomic analysis of wheat proteins recognized by IgE antibodies of allergic patients. Proteomics. 2008
Species Uniqueness
Species containing the peptide DFEEPGHLAPTGLFLGGTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Eucalyptus grandis | Eucalyptus grandis | XP_010049601 XP_010049601 XP_010049601 XP_010049601 |
71139 |
| Triticum aestivum | Bread wheat | ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 |
4565 |
| Triticum urartu | Triticum urartu | EMS51692 EMS51692 EMS51692 EMS51692 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.