Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY
Species containing the peptide DFEEPGHLAPTGLFLGGTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Eucalyptus grandis | Eucalyptus grandis | XP_010049601 XP_010049601 XP_010049601 XP_010049601 |
71139 |
| Triticum aestivum | Bread wheat | ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 |
4565 |
| Triticum urartu | Triticum urartu | EMS51692 EMS51692 EMS51692 EMS51692 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.