YMVIQGEPGVVIR peptide from Tri-a-12 - Allergen Peptide Browser

If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: YMVIQGEPGVVIR

Peptide within the protein Tri-a-12:

Isoform: Tri-a-12.0101

MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY

Isoform: Tri-a-12.0102

MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY

Isoform: Tri-a-12.0103

MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY

Isoform: Tri-a-12.0104

MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVERLGDYLIDQGY

References reporting this peptide:

Šotkovský, et al. Proteomic analysis of wheat proteins recognized by IgE antibodies of allergic patients. Proteomics. 2008

Species Uniqueness

Warning: nonspecific peptide

Food	Protein	Taxid
Wheat	Hor-v-12.0101	4513
Wheat	Tri-a-12.0101	4565
Wheat	Tri-a-12.0102	4565
Wheat	Tri-a-12.0103	4565
Wheat	Tri-a-12.0104	4565

Species containing the peptide YMVIQGEPGVVIR are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name	Common name	Accession(s)	Tax ID
Hordeum vulgare subsp. vulgare	Domesticated barley	P52184 BAK02673 P52184 BAK02673 P52184 BAK02673 P52184 BAK02673 P52184 BAK02673	112509
Ananas comosus	Pineapple	Q94JN2 Q94JN2 Q94JN2 Q94JN2 Q94JN2	4615
Brachypodium distachyon	Brachypodium distachyon	XP_003564327 XP_003564327 XP_003564327 XP_003564327 XP_003564327	15368
Capsicum annuum	Capsicum annuum	XP_016537636 XP_016537636 XP_016537636 XP_016537636 XP_016537636	4072
Corylus avellana	Corylus avellana	A4KA43 A4KA43 A4KA43 A4KA43 A4KA43	13451
Crocus sativus	Crocus sativus	Q5EF31 Q5EF31 Q5EF31 Q5EF31 Q5EF31	82528
Glycine max	Soybean	NP_001235595 NP_001235595 NP_001235595 NP_001235595 NP_001235595	3847
Hordeum vulgare	Hordeum vulgare	P52184 P52184 P52184 P52184 P52184	4513
Malus domestica	Apple	AAX19857 AAX19859 XP_008337609 Q9XF41 CAK93713 CAD46560 AAX19857 AAX19859 XP_008337609 Q9XF41 CAK93713 CAD46560 AAX19857 AAX19859 XP_008337609 Q9XF41 CAK93713 CAD46560 AAX19857 AAX19859 XP_008337609 Q9XF41 CAK93713 CAD46560 AAX19857 AAX19859 XP_008337609 Q9XF41 CAK93713 CAD46560	3750
Musa acuminata subsp. malaccensis	Wild malaysian banana	XP_009413861 XP_009413861 XP_009413861 XP_009413861 XP_009413861	214687
Oryza brachyantha	Malo sina	XP_006645591 XP_006655796 XP_006645591 XP_006655796 XP_006645591 XP_006655796 XP_006645591 XP_006655796 XP_006645591 XP_006655796	4533
Oryza sativa Indica Group	Long-grained rice	XP_015642483 XP_015642483 XP_015642483 XP_015642483 XP_015642483	39946
Oryza sativa Japonica Group	Japanese rice	XP_015642483 XP_015642483 XP_015642483 XP_015642483 XP_015642483	39947
Picea sitchensis	Sitka spruce	ADE76912 ADE76912 ADE76912 ADE76912 ADE76912	3332
Pyrus x bretschneideri	Pyrus x bretschneideri	XP_009352571 XP_009352571 XP_009352571 XP_009352571 XP_009352571	225117
Saccharum hybrid cultivar R570	Saccharum hybrid cultivar r570	AGT16839 AGT16839 AGT16839 AGT16839 AGT16839	131158
Secale cereale x Triticum durum	Secale cereale x triticum durum	AEW90958 AEW90958 AEW90958 AEW90958 AEW90958	142809
Solanum lycopersicum	Tomato	XP_004251645 XP_004251645 XP_004251645 XP_004251645 XP_004251645	4081
Solanum pennellii	Solanum pennellii	XP_015061195 XP_015061195 XP_015061195 XP_015061195 XP_015061195	28526
Triticum aestivum	Bread wheat	ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122 ACE82291 CAQ57979 P49234 P49233 P49232 ADK35122	4565
Triticum urartu	Triticum urartu	EMS51692 EMS51692 EMS51692 EMS51692 EMS51692	4572
Vitis vinifera	Wine grape	CAN76117 CAN76117 CAN76117 CAN76117 CAN76117	29760
Zea mays	Zea mays	ACF82495 AFW75546 AFW85824 NP_001104885 ACG33212 NP_001105622 5FEF_A XP_008668988 DAA40378 ACF82495 AFW75546 AFW85824 NP_001104885 ACG33212 NP_001105622 5FEF_A XP_008668988 DAA40378 ACF82495 AFW75546 AFW85824 NP_001104885 ACG33212 NP_001105622 5FEF_A XP_008668988 DAA40378 ACF82495 AFW75546 AFW85824 NP_001104885 ACG33212 NP_001105622 5FEF_A XP_008668988 DAA40378 ACF82495 AFW75546 AFW85824 NP_001104885 ACG33212 NP_001105622 5FEF_A XP_008668988 DAA40378	4577

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.