If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: CGSQAGGK
Peptide within the protein Tri-a-18:
MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAITANSTLLQE
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide CGSQAGGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arabis alpina | Gray rockcress | KFK37886 |
50452 |
| Brachypodium distachyon | Brachypodium distachyon | XP_010237391 |
15368 |
| Cajanus cajan | Pigeon pea | KYP71795 |
3821 |
| Camellia sinensis | Camellia sinensis | AKM77643 |
4442 |
| Elaeis guineensis | African oil palm | XP_010941404 XP_010941401 |
51953 |
| Eucalyptus grandis | Eucalyptus grandis | KCW55631 XP_010028812 |
71139 |
| Hordeum vulgare | Hordeum vulgare | P15312 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | P15312 |
112509 |
| Setaria italica | Foxtail millet | KQL15589 |
4555 |
| Triticum aestivum | Bread wheat | 1WGC_A 2X52_A 2X52_A P10969 P10969 1WGT_A 1WGT_A P10968 |
4565 |
| Triticum durum | Durum wheat | P10969 P10969 |
4567 |
| Triticum urartu | Triticum urartu | EMS64751 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.