If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GCQNGACWTSK
Peptide within the protein Tri-a-18:
MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAITANSTLLQE
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GCQNGACWTSK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Triticum aestivum | Bread wheat | 1WGC_A 2WGC_A 2X52_A P10969 1WGT_A P10968 P02876 |
4565 |
| Triticum durum | Durum wheat | P10969 |
4567 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.