Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKTFIIFVLLAMAMNIASASRLLSPRGKELHTPQEQFPQQQQFPQPQQFPQQQIPQQHQIPQQPQQFPQQQQFLQQQQIPQQQIPQQHQIPQQPQQFPQQQQFPQQHQSPQQQFPQQQFPQQKLPQQEFPQQQISQQPQQLPQQQQIPQQPQQFLQQQQFPQQQPPQQHQFPQQQLPQQQQIPQQQQIPQQPQQIPQQQQIPQQPQQFPQQQFPQQQFPQQQFPQQEFPQQQQFPQQQIARQPQQLPQQQQIPQQPQQFPQQQQFPQQQSPQQQQFPQQQFPQQQQLPQKQFPQPQQIPQQQQIPQQPQQFPQQQFPQQQQFPQQQEFPQQQFPQQQFHQQQLPQQQFPQQQFPQQQFPQQQQFPQQQQLTQQQFPRPQQSPEQQQFPQQQFPQQPPQQFPQQQFPIPYPPQQSEEPSPYQQYPQQQPSGSDVISISGL
None.
Species containing the peptide TFIIFVLLAMAMNIASASR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Lophopyrum elongatum | Lophopyrum elongatum | AER58003 AER58003 |
4588 |
| Triticum aestivum | Bread wheat | ALG75822 ALG75826 ALG75827 ALG75831 ALG75824 ALG75829 ALG75830 AJG03082 AJG03088 ALG75825 ALG75823 AJG03087 ALG75828 AJG03081 AJG03089 AJG03084 AJG03090 AJG03091 AJG03096 AJG03092 AJG03080 AJG03093 BAE20328 ALG75822 ALG75826 ALG75827 ALG75831 ALG75824 ALG75829 ALG75830 AJG03082 AJG03088 ALG75825 ALG75823 AJG03087 ALG75828 AJG03081 AJG03089 AJG03084 AJG03090 AJG03091 AJG03096 AJG03092 AJG03080 AJG03093 BAE20328 |
4565 |
| Triticum dicoccoides | Triticum dicoccoides | AKA88519 AKA88518 AKA88517 AKA88520 AKA88514 AKA88507 AKA88511 AKA88515 AKA88508 AKA88512 AKA88506 AKA88509 AKA88516 AKA88519 AKA88518 AKA88517 AKA88520 AKA88514 AKA88507 AKA88511 AKA88515 AKA88508 AKA88512 AKA88506 AKA88509 AKA88516 |
85692 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.