If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VGLHAAQ
Peptide within the protein Tri-a-25:
MAASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLHAAQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VGLHAAQ are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Alligator mississippiensis | American alligator | KYO33083 XP_006276956 XP_014460965 |
8496 |
| Alligator sinensis | Chinese alligator | XP_006025293 XP_014376146 |
38654 |
| Arthrobotrys oligospora ATCC 24927 | Arthrobotrys oligospora atcc 24927 | XP_011122728 |
756982 |
| Baudoinia compniacensis UAMH 10762 | Baudoinia compniacensis uamh 10762 | XP_007675355 |
717646 |
| Heterobasidion irregulare TC 32-1 | Heterobasidion irregulare tc 32-1 | XP_009548044 |
747525 |
| Schizopora paradoxa | Schizopora paradoxa | KLO14028 |
27342 |
| Thalassiosira oceanica | Thalassiosira oceanica | EJK52525 |
159749 |
| Triticum aestivum | Bread wheat | CAB96931 O64394 |
4565 |
| Verticillium alfalfae VaMs.102 | Verticillium alfalfae vams.102 | XP_003005258 |
526221 |
| Verticillium dahliae VdLs.17 | Verticillium dahliae vdls.17 | XP_009649146 |
498257 |
| Verticillium longisporum | Verticillium longisporum | CRK28208 CRK13120 CRK13109 |
100787 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.