Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TLPTMCR
Peptide within the protein Tri-a-36:
MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPFSQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPFGVGTGVGSY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TLPTMCR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops longissima | Aegilops longissima | ALS92746 ALS92749 ALS92748 ALS92751 |
4486 |
| Aegilops searsii | Aegilops searsii | ALS92754 ALS92753 |
4487 |
| Aegilops sharonensis | Aegilops sharonensis | ALS92759 ALS92757 ALS92758 ALS92755 |
58530 |
| Aegilops speltoides | Aegilops speltoides | ACV32583 |
4573 |
| Aegilops tauschii | Aegilops tauschii | ABB90587 AFX69642 ABO09764 ABO09763 ABO09761 ABO09765 ABO09766 ABO09767 ABO09762 ACY08827 ABC84367 |
37682 |
| Thinopyrum ponticum x Triticum aestivum | Thinopyrum ponticum x triticum aestivum | AAV75996 AAV75997 |
222994 |
| Triticum aestivum | Bread wheat | ACZ51338 AAT36484 ABD72601 AAV91998 BAN29069 AAV92014 ABI21863 BAB78750 AGO17764 AGK83348 AGK83148 AGK83270 AGO17762 AEI00668 AFI81553 AFI81534 AGO17758 BAB78749 AEI00680 AEI00679 AEI00678 AEI00677 ABC84367 ABC84366 BAJ09388 AFU48613 AFU48612 ACA63873 ACA63857 ACA63856 AGO17742 ACY08822 |
4565 |
| Triticum aestivum x Lophopyrum elongatum | Triticum aestivum x lophopyrum elongatum | ABX84155 |
488177 |
| Triticum timopheevii | Triticum timopheevii | ACU65076 |
4570 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.