If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LCAGVCR
Peptide within the protein Tri-a-37:
MGSKGFKGVIVCLLILGLVLEQLQVEGKSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPKLALESNSDEPDTIEYCNLGCRSSVCDYMVNAAADDEEMKLYVENCADACVSFCNGDAGLPSLDAY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LCAGVCR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Anser cygnoides domesticus | Anser cygnoides domesticus | XP_013055866 |
381198 |
| Aquila chrysaetos canadensis | Aquila chrysaetos canadensis | XP_011573278 |
216574 |
| Bathycoccus prasinos | Bathycoccus prasinos | XP_007511518 |
41875 |
| Cyprinodon variegatus | Cyprinodon variegatus | XP_015256150 |
28743 |
| Escovopsis weberi | Escovopsis weberi | KOS21702 |
150374 |
| Haliaeetus leucocephalus | Bald eagle | XP_010561258 |
52644 |
| Hordeum vulgare | Hordeum vulgare | P01545 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | 0603243A AAA32966 |
112509 |
| Mesitornis unicolor | Brown roatelo | KFQ29432 XP_010192932 |
54374 |
| Monodelphis domestica | Gray short-tailed opossum | XP_007507917 |
13616 |
| Triticum aestivum | Bread wheat | 2PLH_A CAA65314 AFQ60540 P01544 CAA65313 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.