If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NCYNLCR
Peptide within the protein Tri-a-37:
MGSKGFKGVIVCLLILGLVLEQLQVEGKSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFPKLALESNSDEPDTIEYCNLGCRSSVCDYMVNAAADDEEMKLYVENCADACVSFCNGDAGLPSLDAY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NCYNLCR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | EMT02033 |
37682 |
| Avena sativa | Oat | 0807220A 0807220B |
4498 |
| Brachypodium distachyon | Brachypodium distachyon | KQJ81365 XP_003561421 |
15368 |
| Hordeum vulgare | Hordeum vulgare | 1WUW_A P01545 P21742 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | 0603243A 1206255A AAA32966 P21742 BAK05635 |
112509 |
| Secale cereale | Rye | CAA65316 |
4550 |
| Triticum aestivum | Bread wheat | 1BHP_A 2PLH_A AFQ60540 P01544 P01543 BAA12336 P32032 CAA65312 CAA65313 |
4565 |
| Triticum monococcum subsp. aegilopoides | Triticum monococcum subsp. aegilopoides | ACL11908 ACL11906 ACL11901 ACL11898 ACL11896 ACL11894 ACL11893 |
52163 |
| Triticum monococcum subsp. monococcum | Triticum monococcum subsp. monococcum | ACL11917 ACL11913 ACL11910 ACL11893 |
408188 |
| Triticum urartu | Triticum urartu | ACL11925 ACL11920 ACL11893 EMS60935 ACL11922 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.