If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: IEMPGPPYLAK
Peptide within the protein Tri-a-40:
MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQWS
References reporting this peptide:
- Uvackova, et al. MSE Based Multiplex Protein Analysis Quantified Important Allergenic Proteins and Detected Relevant Peptides Carrying Known Epitopes in Wheat Grain Extracts. Journal of Proteome Research. 2013
Species Uniqueness
Species containing the peptide IEMPGPPYLAK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | EMT10686 |
37682 |
| Triticum aestivum | Bread wheat | CAA42453 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.