If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SRPDQSGLMELPGCPR
Peptide within the protein Tri-a-40:
MASKSNYNLLFTALLVFIFAAVAAVGNEDCTPWTSTLITPLPSCRNYVEEQACRIEMPGPPYLAKQECCEQLANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMNFVPILVTPGYCNLTTVHNTPYCLGMEESQWS
References reporting this peptide:
- Uvackova, et al. MSE Based Multiplex Protein Analysis Quantified Important Allergenic Proteins and Detected Relevant Peptides Carrying Known Epitopes in Wheat Grain Extracts. Journal of Proteome Research. 2013
- Šotkovský, et al. Proteomic analysis of wheat proteins recognized by IgE antibodies of allergic patients. Proteomics. 2008
Species Uniqueness
Species containing the peptide SRPDQSGLMELPGCPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | EMT10686 |
37682 |
| Hordeum vulgare | Hordeum vulgare | P32936 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | P32936 |
112509 |
| Secale cereale | Rye | AAZ67071 |
4550 |
| Triticum aestivum | Bread wheat | ACG59281 P16159 CAA42453 |
4565 |
| Triticum durum | Durum wheat | P16159 |
4567 |
| Triticum macha | Triticum macha | ACM41416 |
69994 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.