If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QDIQYMLR
Peptide within the protein Tri-a-41:
EMGDGQLCVICLRKRRRAAFVPCGHLVCCCNCAKRVELMDEPLCPVCRQDIQYMLRVYDS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QDIQYMLR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Brachypodium distachyon | Brachypodium distachyon | XP_003558679 |
15368 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | BAK06118 |
112509 |
| Triticum aestivum | Bread wheat | AKJ77988 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.