If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ATLSLFK
Peptide within the protein Tri-a-43:
MTLVASSSLDPVWVEVLGDPLLRRLLLRFIFCRATLSLFKASNDKAECLPSCVPPLPESVGGESMLSQCCVMRVASFLGAADQFSFAEVTTWPDIDEPTSSGGVDKEL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide ATLSLFK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | EMT17403 |
37682 |
| Alternaria alternata | Alternaria alternata | OAG13563 |
5599 |
| Aphanomyces astaci | Aphanomyces astaci | XP_009836810 |
112090 |
| Ashbya gossypii ATCC 10895 | Ashbya gossypii atcc 10895 | Q753C1 NP_985942 |
284811 |
| Ashbya gossypii FDAG1 | Ashbya gossypii fdag1 | NP_985942 |
1034331 |
| Bodo saltans | Bodo saltans | CUG93875 |
75058 |
| Caenorhabditis remanei | Caenorhabditis remanei | XP_003113888 XP_003113786 |
31234 |
| Camelina sativa | Camelina sativa | XP_010465306 XP_010465297 XP_010465289 |
90675 |
| Dasypus novemcinctus | Nine-banded armadillo | XP_004461886 |
9361 |
| Fonsecaea erecta | Fonsecaea erecta | OAP54104 |
1367422 |
| Marssonina brunnea f. sp. 'multigermtubi' MB_m1 | Marssonina brunnea f. sp. 'multigermtubi' mb_m1 | XP_007297073 |
1072389 |
| Passiflora ambigua | Passiflora ambigua | AFI17000 AID22026 AID22023 AID22025 AID22024 |
196576 |
| Passiflora aurantioides | Passiflora aurantioides | BAL63380 |
378244 |
| Passiflora auriculata | Passiflora auriculata | AID22027 AID22028 |
196577 |
| Passiflora bicornis | Passiflora bicornis | AFI17001 |
1129465 |
| Passiflora biflora | Passiflora biflora | AID22030 AID22029 ACZ62992 AFI17001 |
196578 |
| Passiflora coccinea | Passiflora coccinea | ABR22773 |
85237 |
| Passiflora coriacea | Passiflora coriacea | AID22031 AID22032 |
196579 |
| Passiflora costaricensis | Passiflora costaricensis | AFI17009 AFI17008 |
1129466 |
| Passiflora herbertiana | Passiflora herbertiana | AJW74100 |
237855 |
| Passiflora laurifolia | Passiflora laurifolia | ANA76528 |
237862 |
| Passiflora platyloba | Passiflora platyloba | AIF32298 AFI17011 |
196583 |
| Passiflora quadrangularis | Granadilla | AIF32282 ACT52339 BAF40606 |
3685 |
| Passiflora sp. RP-2014 | Passiflora sp. rp-2014 | AIF32304 AIF32289 AIF32287 AIF32281 AIF32280 |
1520716 |
| Passiflora suberosa | Passiflora suberosa | ABD64662 ACZ97653 |
133504 |
| Passiflora tetrandra | Passiflora tetrandra | BAL63399 |
237885 |
| Passiflora vitifolia | Passiflora vitifolia | AID22034 AID22033 AID22035 |
196585 |
| Passiflora wilsonii | Passiflora wilsonii | CDF63832 |
338815 |
| Pneumocystis jirovecii | Pneumocystis jirovecii | CCJ28360 CCJ30571 |
42068 |
| Pneumocystis jirovecii RU7 | Pneumocystis jirovecii ru7 | CCJ30571 |
1408657 |
| Pogonomyrmex barbatus | Red harvester ant | XP_011644731 XP_011644730 XP_011644729 |
144034 |
| Pyrus x bretschneideri | Pyrus x bretschneideri | XP_009365599 XP_009348159 |
225117 |
| Saccharomycetaceae sp. 'Ashbya aceri' | Saccharomycetaceae sp. 'ashbya aceri' | AGO11084 |
566037 |
| Scheffersomyces stipitis CBS 6054 | Scheffersomyces stipitis cbs 6054 | XP_001387822 |
322104 |
| Setaria italica | Foxtail millet | XP_004957524 KQL25538 |
4555 |
| Strigomonas culicis | Strigomonas culicis | EPY19205 |
28005 |
| Strongyloides ratti | Strongyloides ratti | CEF65967 |
34506 |
| Theobroma cacao | Cacao | XP_007029233 EOY09735 |
3641 |
| Thermococcus peptonophilus | Thermococcus peptonophilus | WP_062389585 |
53952 |
| Triticum aestivum | Bread wheat | AKJ77987 |
4565 |
| Triticum urartu | Triticum urartu | EMS63217 |
4572 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.