If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AAAKPPPR
Peptide within the protein Tri-a-45:
MGKRKAAAKPPPRKGMDKLDTVFSCPFCNHGSSVECRIDLKNLIGEANCQICQESFSTTANALTEAIDVYSEWIDECERVNTVEGDDGA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AAAKPPPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii | Aegilops tauschii | EMT07146 |
37682 |
| Drosophila pseudoobscura pseudoobscura | Drosophila pseudoobscura pseudoobscura | XP_003736616 |
46245 |
| Fibulorhizoctonia sp. CBS 109695 | Fibulorhizoctonia sp. cbs 109695 | KZP16626 |
436010 |
| Gonium pectorale | Gonium pectorale | KXZ50033 |
33097 |
| Hebeloma cylindrosporum h7 | Hebeloma cylindrosporum h7 | KIM43835 |
686832 |
| Hydnomerulius pinastri MD-312 | Hydnomerulius pinastri md-312 | KIJ67220 |
994086 |
| Monoraphidium neglectum | Monoraphidium neglectum | XP_013902573 |
145388 |
| Saprolegnia parasitica CBS 223.65 | Saprolegnia parasitica cbs 223.65 | XP_012199866 |
695850 |
| Strigomonas culicis | Strigomonas culicis | EPY20663 |
28005 |
| Triticum aestivum | Bread wheat | AKJ77985 |
4565 |
| Trypanosoma grayi | Trypanosoma grayi | XP_009313285 |
71804 |
| Vitrella brassicaformis CCMP3155 | Vitrella brassicaformis ccmp3155 | CEM07568 |
1169540 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.