If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AIDVNGDGK
Peptide within the protein Lit-v-4:
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
References reporting this peptide:
- Ayuso, et al. Sarcoplasmic calcium-binding protein is an EF-hand-type protein identified as a new shrimp allergen.. Journal of Allergy and Clinical Immunology. 2009
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-4.0101 | 6689 |
| Shrimp | Pen-m-4.0101 | 6687 |
Species containing the peptide AIDVNGDGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Fenneropenaeus orientalis | Fenneropenaeus orientalis | 1006232A 1006232A |
70917 |
| Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 |
6689 |
| Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
| Penaeus sp. | Penaeus sp. | P02636 P02636 |
6688 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.