If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

White%252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252520shrimp Protein: Lit v 2 | Arginine Kinase

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 356 amino acids

MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM

UniProt: Q004B5   IUIS: Lit v 2

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1 Peptide 2 Exp.3 ESP4 CONSeQ5
^ MADAAVIEK L 0 0.285 0.61974
K LEAATDCK S 0 0.285 0.42948
K DFGDVNSFVNVDPEGK F 0 0.788 0.6195
R SLQGYPFNPCLTESQYK E 0 0.696 0.25148
K VSSTLSSLEGELK G 0 0.591 0.63826
K GTYYPLTGMSK E 0 0.423 0.48262
K LIDDHFLFK E 0 0.536 0.15114
R FLQAANACR Y 0 0.359 0.59176
R GIYHNDNK T 0 0.293 0.18474
K TFLVWVNEEDHLR I 0 0.601 0.11136
R IISMQMGGDLGQVFR R 0 0.505 0.30296
R LTSAVNEIEK R 0 0.425 0.79752
R IPFSHHDR L 0 0.332 0.23118
R LGFLTFCPTNLGTTVR A 0 0.643 0.25382
K LEEVAGK Y 0 0.218 0.14898
R GEHTEAEGGIYDISNK R 0 0.634 0.59944
R MGLTEFQAVK E 0 0.369 0.60788
K EMQDGILELIK I 0 0.408 0.4763

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.