Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
White%25252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252520shrimp Protein: Lit v 2 | Arginine Kinase
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 356 amino acids
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM
UniProt: Q004B5 IUIS: Lit v 2Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | MADAAVIEK | L | 0 | 0.285 | 0.61974 |
| K | LEAATDCK | S | 0 | 0.285 | 0.42948 |
| K | DFGDVNSFVNVDPEGK | F | 0 | 0.788 | 0.6195 |
| R | SLQGYPFNPCLTESQYK | E | 0 | 0.696 | 0.25148 |
| K | VSSTLSSLEGELK | G | 0 | 0.591 | 0.63826 |
| K | GTYYPLTGMSK | E | 0 | 0.423 | 0.48262 |
| K | LIDDHFLFK | E | 0 | 0.536 | 0.15114 |
| R | FLQAANACR | Y | 0 | 0.359 | 0.59176 |
| R | GIYHNDNK | T | 0 | 0.293 | 0.18474 |
| K | TFLVWVNEEDHLR | I | 0 | 0.601 | 0.11136 |
| R | IISMQMGGDLGQVFR | R | 0 | 0.505 | 0.30296 |
| R | LTSAVNEIEK | R | 0 | 0.425 | 0.79752 |
| R | IPFSHHDR | L | 0 | 0.332 | 0.23118 |
| R | LGFLTFCPTNLGTTVR | A | 0 | 0.643 | 0.25382 |
| K | LEEVAGK | Y | 0 | 0.218 | 0.14898 |
| R | GEHTEAEGGIYDISNK | R | 0 | 0.634 | 0.59944 |
| R | MGLTEFQAVK | E | 0 | 0.369 | 0.60788 |
| K | EMQDGILELIK | I | 0 | 0.408 | 0.4763 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.