Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: MADAAVIEK
Peptide within the protein Lit-v-2:
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-2.0101 | 6689 |
| Shrimp | Pen-m-2.0101 | 6687 |
Species containing the peptide MADAAVIEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | AAV83993 AAV83993 |
139456 |
| Fenneropenaeus merguiensis | Fenneropenaeus merguiensis | ACP43442 ACP43442 |
71412 |
| Litopenaeus vannamei | Pacific white shrimp | 4BHL_A 4BG4_B 4BG4_A ABY57915 ABI98020 4BHL_A 4BG4_B 4BG4_A ABY57915 ABI98020 |
6689 |
| Metapenaeus ensis | Metapenaeus ensis | ACA51932 ACA51932 |
32278 |
| Penaeus monodon | Black tiger shrimp | AAO15713 AGV55412 C7E3T4 AAO15713 AGV55412 C7E3T4 |
6687 |
| Scylla paramamosain | Green mud crab | AFA45340 AFA45340 |
85552 |
| Scylla serrata | Giant mud crab | ACV96855 ACV96855 |
6761 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.