Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
White-shrimp Protein: Lit v 3 | Myosin, Light Chain 2
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 177 amino acids
MSRKSGSRSSSKRSKKSGGGSNVFDMFTQRQVAEFKEGFQLMDRDKDGVIGKTDLRGTFDEIGRIATDQELDEMLADAPAPINFTMLLNMFAERQTGESDDDDVVAKAFLAFADEEGNIDCDTFRHALMTWGDKFSSQEADDALDQMDIDDGGKIDVQGVIQMLTAGGGDDAAAEEA
UniProt: B7SNI3 IUIS: Lit v 3Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| K | SGGGSNVFDMFTQR | Q | 0 | 0.662 | 0.58524 |
| K | EGFQLMDR | D | 0 | 0.316 | 0.46266 |
| R | GTFDEIGR | I | 0 | 0.303 | 0.51882 |
| R | IATDQELDEMLADAPAPINFTMLLNMFAER | Q | 0 | 0.42 | 0.05624 |
| R | QTGESDDDDVVAK | A | 0 | 0.653 | 0.23452 |
| K | AFLAFADEEGNIDCDTFR | H | 0 | 0.624 | 0.09362 |
| R | HALMTWGDK | F | 0 | 0.312 | 0.21084 |
| K | FSSQEADDALDQMDIDDGGK | I | 0 | 0.63 | 0.4598 |
| K | IDVQGVIQMLTAGGGDDAAAEEA | $ | 0 | 0.462 | 0.4368 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.