If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: EIDDAYNK
Peptide within the protein Lit-v-4:
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-4.0101 | 6689 |
| Shrimp | Pen-m-4.0101 | 6687 |
| Crayfish | Pon-l-4.0101 | 6717 |
Species containing the peptide EIDDAYNK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Beauveria bassiana ARSEF 2860 | Beauveria bassiana arsef 2860 | XP_008602114 XP_008602114 XP_008602114 |
655819 |
| Beauveria bassiana D1-5 | Beauveria bassiana d1-5 | KGQ06541 KGQ06541 KGQ06541 |
1245745 |
| Cordyceps confragosa | Cordyceps confragosa | OAR03115 OAR03115 OAR03115 |
1105325 |
| Cordyceps confragosa RCEF 1005 | Cordyceps confragosa rcef 1005 | OAA78668 OAA78668 OAA78668 |
1081108 |
| Cordyceps militaris CM01 | Cordyceps militaris cm01 | XP_006667304 XP_006667304 XP_006667304 |
983644 |
| Eriocheir sinensis | Chinese mitten crab | AJG01361 AJG01360 AJG01359 AJG01361 AJG01360 AJG01359 AJG01361 AJG01360 AJG01359 |
95602 |
| Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 ACM89179 |
6689 |
| Palaemonetes varians | Atlantic ditch shrimp | ACR54113 ACR54113 ACR54113 |
647170 |
| Penaeus monodon | Black tiger shrimp | ACM89179 ACM89179 ACM89179 |
6687 |
| Pontastacus leptodactylus | Narrow-clawed crayfish | P05946 P05946 P05946 |
6717 |
| Procambarus clarkii | Red swamp crayfish | AFV09840 ABB58783 AEG79569 AEG79568 AEG79567 AFV09840 ABB58783 AEG79569 AEG79568 AEG79567 AFV09840 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.