If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: IGIDEFAALVK
Peptide within the protein Thu-a-1:
MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide IGIDEFAALVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Austrofundulus limnaeus | Austrofundulus limnaeus | XP_013862405 |
52670 |
| Danio rerio | Zebrafish | NP_997948 |
7955 |
| Haplochromis burtoni | Burton's mouthbrooder | XP_005734654 |
8153 |
| Kryptolebias marmoratus | Mangrove rivulus | XP_017272259 |
37003 |
| Maylandia zebra | Zebra mbuna | XP_004558442 |
106582 |
| Neolamprologus brichardi | Neolamprologus brichardi | XP_006791597 |
32507 |
| Notothenia coriiceps | Black rockcod | XP_010767863 |
8208 |
| Oreochromis mossambicus | Mozambique tilapia | AAZ52553 |
8127 |
| Oreochromis niloticus | Nile tilapia | XP_003452874 |
8128 |
| Poecilia formosa | Amazon molly | XP_007565761 |
48698 |
| Poecilia latipinna | Sailfin molly | XP_007565761 |
48699 |
| Poecilia mexicana | Poecilia mexicana | XP_007565761 |
48701 |
| Pundamilia nyererei | Pundamilia nyererei | XP_005734654 |
303518 |
| Squalius cephalus | European chub | P05939 |
8284 |
| Thunnus albacares | Yellowfin tuna | CAQ72967 |
8236 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.