If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ELSDIAHK
Peptide within the protein Thu-a-3:
PHAFPFLTPEQKKELSDIAHKIVAPGKGILAADESTG
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide ELSDIAHK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Biomphalaria glabrata | Biomphalaria glabrata | XP_013085543 XP_013085542 |
6526 |
| Clupea harengus | Atlantic herring | XP_012693155 |
7950 |
| Cyprinodon variegatus | Cyprinodon variegatus | XP_015249725 |
28743 |
| Esox lucius | Northern pike | NP_001290811 |
8010 |
| Notothenia coriiceps | Black rockcod | XP_010782556 |
8208 |
| Oncorhynchus mykiss | Rainbow trout | CDQ58842 |
8022 |
| Salmo salar | Atlantic salmon | NP_001133180 CBL79147 |
8030 |
| Takifugu rubripes | Torafugu | XP_011601126 |
31033 |
| Thunnus albacares | Yellowfin tuna | P86979 |
8236 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.