If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NLWNEIAELADFNK
Peptide within the protein Pen-m-4:
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
References reporting this peptide:
- Ayuso, et al. Sarcoplasmic calcium-binding protein is an EF-hand-type protein identified as a new shrimp allergen.. Journal of Allergy and Clinical Immunology. 2009
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-4.0101 | 6689 |
| Shrimp | Pen-m-4.0101 | 6687 |
Species containing the peptide NLWNEIAELADFNK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Penaeus sp. | Penaeus sp. | P02635 P02636 P02635 P02636 |
6688 |
| Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
| Pontastacus leptodactylus | Narrow-clawed crayfish | P05946 P05946 |
6717 |
| Crangon crangon | Crangon crangon | ACR43475 ACR43475 |
491138 |
| Eriocheir sinensis | Chinese mitten crab | AJG01361 AJG01360 AJG01359 AJG01361 AJG01360 AJG01359 |
95602 |
| Fenneropenaeus orientalis | Fenneropenaeus orientalis | P02635 1006232A P02635 1006232A |
70917 |
| Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 |
6689 |
| Palaemonetes varians | Atlantic ditch shrimp | ACR54125 ACR54125 |
647170 |
| Procambarus clarkii | Red swamp crayfish | ABB58783 AEG79569 AEG79568 AEG79567 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
| Rimicaris exoculata | Rimicaris exoculata | ACR48145 ACR48145 |
71621 |
| Scylla paramamosain | Green mud crab | AFJ80778 AFJ80778 |
85552 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.