If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SAFAEVK
Peptide within the protein Pen-m-4:
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-4.0101 | 6689 |
| Shrimp | Pen-m-4.0101 | 6687 |
Species containing the peptide SAFAEVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Fenneropenaeus orientalis | Fenneropenaeus orientalis | 1006232A 1006232A |
70917 |
| Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 |
6689 |
| Albugo laibachii Nc14 | Albugo laibachii nc14 | CCA22500 CCA22500 |
890382 |
| Astyanax mexicanus | Mexican tetra | XP_015462005 XP_015462004 XP_015462006 XP_015462003 XP_015462002 XP_015462001 XP_015462000 XP_007252012 XP_015462005 XP_015462004 XP_015462006 XP_015462003 XP_015462002 XP_015462001 XP_015462000 XP_007252012 |
7994 |
| Aureobasidium subglaciale EXF-2481 | Aureobasidium subglaciale exf-2481 | XP_013344498 XP_013344498 |
1043005 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | KZN07470 KZN07470 |
79200 |
| Octopus bimaculoides | Octopus bimaculoides | XP_014775333 XP_014775333 |
37653 |
| Opisthorchis viverrini | Opisthorchis viverrini | XP_009169103 XP_009169103 |
6198 |
| Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
| Penaeus sp. | Penaeus sp. | P02636 P02636 |
6688 |
| Philomachus pugnax | Philomachus pugnax | XP_014808081 XP_014808081 |
198806 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.