If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ALPMHIR
Peptide within the protein Bos-d-5:
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide ALPMHIR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bison bison bison | Bison | XP_010855058 |
43346 |
| Bos mutus | Wild yak | XP_005888577 |
72004 |
| Bos taurus | Cattle | AAA30412 AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 732164A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
| Bubalus bubalis | Water buffalo | 0601265A ABG78270 P02755 NP_001277893 |
89462 |
| Capra hircus | Goat | ACC44861 4TLJ_A ABQ51182 NP_001272468 |
9925 |
| Ovis aries | Sheep | 4CK4_A 4NLI_A 4CK4_B NP_001009366 |
9940 |
| Ovis aries musimon | Mouflon | P67975 |
9938 |
| Ovis sp. | Sheep | AAA31510 |
9939 |
| Pantholops hodgsonii | Chiru | XP_005963286 |
59538 |
| Piriformospora indica DSM 11827 | Piriformospora indica dsm 11827 | CCA77202 |
1109443 |
| Rangifer tarandus | Reindeer | 1YUP_A |
9870 |
| Rangifer tarandus tarandus | Reindeer | AAZ57420 |
86329 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.