If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: IDALNENK
Peptide within the protein Bos-d-5:
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
References reporting this peptide:
- Figeys D., et al. Protein identification by capillary zone electrophoresis/microelectrospray ionization-tandem mass spectrometry at the subfemtomole level. Analytical Chemistry. 1996
Species Uniqueness
Species containing the peptide IDALNENK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Rangifer tarandus | Reindeer | 1YUP_A |
9870 |
| Bison bison bison | Bison | XP_010855058 |
43346 |
| Bos grunniens | Domestic yak | AFB74992 AFB74990 |
30521 |
| Bos mutus | Wild yak | XP_005888577 |
72004 |
| Bos taurus | Cattle | AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
| Bovine viral diarrhea virus 1 | Bovine viral diarrhea virus 1 | AKF02743 |
11099 |
| Bubalus bubalis | Water buffalo | 0601265A ABG78270 P02755 NP_001277893 |
89462 |
| Capra hircus | Goat | 4TLJ_A ABQ51182 NP_001272468 |
9925 |
| Ovis aries | Sheep | CAA30059 4CK4_A 4NLI_A 4CK4_B NP_001009366 |
9940 |
| Ovis aries musimon | Mouflon | P67975 |
9938 |
| Ovis sp. | Sheep | AAA31510 |
9939 |
| Pantholops hodgsonii | Chiru | XP_005963286 |
59538 |
| Polistes canadensis | Polistes canadensis | XP_014604098 XP_014604097 |
91411 |
| Rangifer tarandus tarandus | Reindeer | AAZ57420 |
86329 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.