If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TPEVDDEALEK
Peptide within the protein Bos-d-5:
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
References reporting this peptide:
- Lutter P., et al. Development and Validation of a Method for the Quantification of Milk Proteins in Food Products Based on Liquid Chromatography with Mass Spectrometric Detection. Journal of AOAC International. 2011
- Monaci L., et al. Multi-allergen detection in food by micro high-performance liquid chromatography coupled to a dual cell linear ion trap mass spectrometry. Journal of Chromatography A. 2014
- Parker, et al. Multi-allergen Quantitation and the Impact of Thermal Treatment in Industry-Processed Baked Goods by ELISA and Liquid Chromatography-Tandem Mass Spectrometry.. Journal of Agricultural and Food Chemistry. 2015
- Pilolli, et al. In house validation of a high resolution mass spectrometry Orbitrap-based method for multiple allergen detection in a processed model food. Analytical and Bioanalytical Chemistry. 2018
- Yang W., et al. Development of an SI-Traceable HPLC–Isotope Dilution Mass Spectrometry Method To Quantify β-Lactoglobulin in Milk Powders. Journal of Agricultural and Food Chemistry. 2014
Species Uniqueness
Species containing the peptide TPEVDDEALEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bison bison bison | Bison | XP_010855058 |
43346 |
| Bos mutus | Wild yak | XP_005888577 |
72004 |
| Bos taurus | Cattle | AAA30412 AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 732164A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
| Bubalus bubalis | Water buffalo | 0601265A ABG78270 P02755 NP_001277893 |
89462 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.