Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
MTDRTQPHTVQVHTTAGRFGDTAAGTNRYPDRGPSTSKVIAVITGLPIGGTLLLFAGLALAGTLLGLAVTTPLFILFSPVIVPAIIVVGLSVAGFLTSGACGLTGLSSFSWVMNYIRQTHGSVPEQLEMAKHRMADVAGYVGQKTKDVGQKTKEVGQEIQTKAQDSKRT
UniProt: Q647G5 IUIS: Ara h 10Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| R | TQPHTVQVHTTAGR | F | 0 | 0.609 | 0.28718 |
| R | FGDTAAGTNR | Y | 0 | 0.39 | 0.60514 |
| R | QTHGSVPEQLEMAK | H | 0 | 0.54 | 0.6246 |
| R | MADVAGYVGQK | T | 0 | 0.369 | 0.7001 |
| K | EVGQEIQTK | A | 0 | 0.258 | 0.5508 |
| R | TQPHAVQVHTTAGR | F | 0 | 0.594 | 0.3306 |
| R | FGDTAAGTNR | Y | 0 | 0.39 | 0.60514 |
| R | QTHGSVPEQLEMAK | H | 0 | 0.54 | 0.6246 |
| R | MADVAGYVGQK | T | 0 | 0.369 | 0.7001 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.