If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GPCLGSK
Peptide within the protein Ara-h-13:
Isoform: Ara-h-13.0101
KECLNLSDKFKGPCLGSKNCDHHCRDIEHLLSGVCRDDFRCWCNRKC
Isoform: Ara-h-13.0102
KVCLNLSDKFKGPCLGTKNCDHHCRDIEHLLSGVCRDDFRCWCNRNC
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GPCLGSK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis hypogaea | Peanut | B3EWP4 |
3818 |
| Aspergillus kawachii IFO 4308 | Aspergillus kawachii ifo 4308 | GAA82814 |
1033177 |
| Aspergillus luchuensis | Aspergillus luchuensis | GAA82814 |
1069201 |
| Aspergillus niger | Aspergillus niger | XP_001401720 GAQ37718 |
5061 |
| Aspergillus niger ATCC 1015 | Aspergillus niger atcc 1015 | XP_001401720 |
380704 |
| Aspergillus niger CBS 513.88 | Aspergillus niger cbs 513.88 | XP_001401720 |
425011 |
| Physeter catodon | Sperm whale | XP_007103066 |
9755 |
| Torrubiella hemipterigena | Torrubiella hemipterigena | CEJ81214 |
1531966 |
| Trichoderma harzianum | Trichoderma harzianum | KKO96588 |
5544 |
| Trichoderma virens Gv29-8 | Trichoderma virens gv29-8 | XP_013950476 |
413071 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.