Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
KECLNLSDKFKGPCLGSKNCDHHCRDIEHLLSGVCRDDFRCWCNRKC
KVCLNLSDKFKGPCLGTKNCDHHCRDIEHLLSGVCRDDFRCWCNRNC
None.
Species containing the peptide GPCLGTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis hypogaea | Peanut | C0HJZ1 |
3818 |
| Bipolaris maydis ATCC 48331 | Bipolaris maydis atcc 48331 | XP_014081789 |
665024 |
| Bipolaris maydis C5 | Bipolaris maydis c5 | EMD92189 |
701091 |
| Bipolaris oryzae ATCC 44560 | Bipolaris oryzae atcc 44560 | XP_007686479 |
930090 |
| Bipolaris sorokiniana ND90Pr | Bipolaris sorokiniana nd90pr | XP_007696843 |
665912 |
| Bipolaris victoriae FI3 | Bipolaris victoriae fi3 | XP_014558843 |
930091 |
| Bipolaris zeicola 26-R-13 | Bipolaris zeicola 26-r-13 | XP_007710761 |
930089 |
| Danaus plexippus | Monarch butterfly | EHJ65574 |
13037 |
| Didymella rabiei | Didymella rabiei | KZM19172 |
5454 |
| Leptosphaeria maculans JN3 | Leptosphaeria maculans jn3 | XP_003843730 |
985895 |
| Phaeosphaeria nodorum SN15 | Phaeosphaeria nodorum sn15 | XP_001801510 |
321614 |
| Setosphaeria turcica Et28A | Setosphaeria turcica et28a | XP_008028695 |
671987 |
| Stagonospora sp. SRC1lsM3a | Stagonospora sp. src1lsm3a | OAL04402 |
765868 |
| Stemphylium lycopersici | Stemphylium lycopersici | KNG51807 |
183478 |
| fungal sp. No.11243 | Fungal sp. no.11243 | GAM87395 |
1603295 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.