Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peanut Protein: Ara h 2 | Conglutin (2S Albumin)
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 160 amino acids
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
UniProt: Q6PSU2-2 IUIS: Ara h 2Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| K | LTILVALALFLLAAHASAR | Q | 0 | 0.333 | 0.24616 |
| R | QQWELQGDR | R | 1 | 0.323 | 0.28132 |
| R | CQSQLER | A | 2 | 0.238 | 0.14318 |
| R | ANLRPCEQHLMQK | I | 1 | 0.23 | 0.29574 |
| R | DEDSYGR | D | 1 | 0.239 | 0.05112 |
| R | DPYSPSQDPYSPSPYDR | R | 1 | 0.621 | 0.3656 |
| R | GAGSSQHQER | C | 1 | 0.314 | 0.133 |
| R | CMCEALQQIMENQSDR | L | 5 | 0.393 | 0.2691 |
| R | QQEQQFK | R | 1 | 0.221 | 0.2018 |
| R | CDLEVESGGR | D | 2 | 0.457 | 0.54436 |
| R | DPYSPSQDPYSPSQDPDR | R | 1 | 0.55 | 0.34104 |
| R | DPYSPSPYDR | R | 1 | 0.396 | 0.29406 |
| R | CCNELNEFENNQR | C | 8 | 0.572 | 0.36492 |
| R | NLPQQCGLR | A | 8 | 0.377 | 0.57668 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.