If you found this site useful, please cite: Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peanut Protein: Ara h 2 | Conglutin (2S Albumin)

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 160 amino acids

MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY

UniProt: Q6PSU2-2   IUIS: Ara h 2

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 172 amino acids

MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY

UniProt: Q6PSU2   IUIS: Ara h 2

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
R CQSQLER A 2 0.238 0.14318
R NLPQQCGLR A 7 0.377 0.57668
R GAGSSQHQER C 1 0.314 0.133
R CCNELNEFENNQR C 7 0.572 0.36492
R DEDSYGR D 1 0.239 0.05112
R CDLEVESGGR D 2 0.457 0.54436
R ANLRPCEQHLMQK I 1 0.23 0.29574
R CMCEALQQIMENQSDR L 5 0.393 0.2691
K LTILVALALFLLAAHASAR Q 0 0.333 0.24616
R QQEQQFK R 1 0.221 0.2018
R QQWELQGDR R 1 0.323 0.28132
R DPYSPSPYDR R 1 0.396 0.29406
R DPYSPSQDPYSPSQDPDR R 1 0.55 0.34104
R DPYSPSQDPYSPSPYDR R 1 0.621 0.3656

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.