If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LGDYLIDTGL
Peptide within the protein Ara-h-5:
MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVERLGDYLIDTGL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LGDYLIDTGL are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis duranensis | Peanut ancestor | XP_015966481 |
130453 |
| Arachis hypogaea | Peanut | 4ESP_A Q9SQI9 ADB96066 AGA84056 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016203797 |
130454 |
| Methanobacterium | Methanobacterium | WP_048080139 |
2160 |
| Methanobacterium sp. A39 | Methanobacterium sp. a39 | WP_069585242 |
1860100 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.