Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peanut Protein: Ara h 8 | Pathogenesis-Related Protein, Pr-10, Bet V 1 Family Member
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 157 amino acids
MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
UniProt: Q6VT83 IUIS: Ara h 8Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | MGVFTFEDEITSTVPPAK | L | 0 | 0.855 | 0.28894 |
| K | DADSITPK | I | 0 | 0.193 | 0.25366 |
| K | SVEIVEGNGGPGTIK | K | 0 | 0.741 | 0.75946 |
| K | LTIVEDGETK | F | 0 | 0.36 | 0.75438 |
| K | VESIDEANYAYNYSVVGGVALPPTAEK | I | 0 | 0.554 | 0.0863 |
| K | LVEGPNGGSIGK | L | 0 | 0.591 | 0.51182 |
| K | GDAKPDEEELK | K | 0 | 0.3 | 0.10638 |
| R | AIEGYVLANPTQY | $ | 0 | 0.528 | 0.54636 |
| ^ | MGVHTFEEESTSPVPPAK | L | 0 | 0.828 | 0.76106 |
| K | ATVVDGDELTPK | L | 0 | 0.692 | 0.85734 |
| K | LIPAIQSIEIVEGNGGPGTVK | K | 0 | 0.791 | 0.28748 |
| K | VTAVEDGK | T | 0 | 0.224 | 0.3603 |
| K | TSYVLHK | I | 0 | 0.273 | 0.17284 |
| K | IDAIDEATYTYDYTISGGTGFQEILEK | V | 0 | 0.295 | 0.04174 |
| K | LEAADGGSK | I | 0 | 0.227 | 0.24784 |
| K | VSVTFHTK | G | 0 | 0.343 | 0.30912 |
| K | GDAPLPDEVHQDVK | Q | 0 | 0.696 | 0.6357 |
| K | AIEGYVLSN | $ | 0 | 0.284 | 0.50902 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.