If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

  1. Home
  2. Peanut
  3. Ara h 8

Peanut Protein: Ara h 8 | Pathogenesis-Related Protein, Pr-10, Bet V 1 Family Member

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 157 amino acids

MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY

UniProt: Q6VT83   IUIS: Ara h 8

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 153 amino acids

MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN

UniProt: B0YIU5   IUIS: Ara h 8

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
^ MGVFTFEDEITSTVPPAK L 0 0.855 0.28894
K DADSITPK I 0 0.193 0.25366
K SVEIVEGNGGPGTIK K 0 0.741 0.75946
K LTIVEDGETK F 0 0.36 0.75438
K VESIDEANYAYNYSVVGGVALPPTAEK I 0 0.554 0.0863
K LVEGPNGGSIGK L 0 0.591 0.51182
K GDAKPDEEELK K 0 0.3 0.10638
R AIEGYVLANPTQY $ 0 0.528 0.54636
^ MGVHTFEEESTSPVPPAK L 0 0.828 0.76106
K ATVVDGDELTPK L 0 0.692 0.85734
K LIPAIQSIEIVEGNGGPGTVK K 0 0.791 0.28748
K VTAVEDGK T 0 0.224 0.3603
K TSYVLHK I 0 0.273 0.17284
K IDAIDEATYTYDYTISGGTGFQEILEK V 0 0.295 0.04174
K LEAADGGSK I 0 0.227 0.24784
K VSVTFHTK G 0 0.343 0.30912
K GDAPLPDEVHQDVK Q 0 0.696 0.6357
K AIEGYVLSN $ 0 0.284 0.50902

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.

 

  1. Home
  2. Peanut
  3. Ara h 8