If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GLLGAAK
Peptide within the protein Ara-h-9:
Isoform: Ara-h-9.0101
MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
Isoform: Ara-h-9.0201
LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GLLGAAK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cryptococcus gattii 99/473 | Cryptococcus gattii 99/473 | KIR28991 |
1296104 |
| Cryptococcus gattii CA1014 | Cryptococcus gattii ca1014 | KIR73584 |
1296107 |
| Acidilobus saccharovorans | Acidilobus saccharovorans | WP_013267065 |
242703 |
| Acidilobus saccharovorans 345-15 | Acidilobus saccharovorans 345-15 | WP_013267065 |
666510 |
| Apis cerana | Asiatic honeybee | XP_016907621 XP_016907620 XP_016907619 XP_016907618 |
7461 |
| Apis dorsata | Giant honeybee | XP_006610443 XP_006610442 XP_006610441 |
7462 |
| Apis florea | Little honeybee | XP_012349910 XP_012349909 XP_012349908 XP_012349907 |
7463 |
| Apis mellifera | Honey bee | XP_016769570 XP_006562599 XP_395983 XP_016769563 XP_006562598 XP_016769558 |
7460 |
| Arachis diogoi | Arachis diogoi | ABY54820 |
170720 |
| Arachis duranensis | Peanut ancestor | XP_015950567 |
130453 |
| Arachis hypogaea | Peanut | ABX75045 |
3818 |
| Athalia rosae | Coleseed sawfly | XP_012257270 XP_012257253 |
37344 |
| Bodo saltans | Bodo saltans | CUG90956 |
75058 |
| Bombus impatiens | Common eastern bumble bee | XP_012248153 XP_003402789 XP_012174460 XP_012174458 |
132113 |
| Bombus terrestris | Buff-tailed bumblebee | XP_003402789 XP_012174460 XP_012174459 XP_012174458 |
30195 |
| Capsicum annuum | Capsicum annuum | XP_016567772 ACB05670 XP_016545939 XP_016545932 XP_016545892 XP_016575084 AAX08122 AAF23460 |
4072 |
| Cephus cinctus | Wheat stem sawfly | XP_015586908 XP_015586907 XP_015586906 XP_015586905 XP_015586904 XP_015586903 XP_015586902 |
211228 |
| Ceratina calcarata | Ceratina calcarata | XP_017887972 XP_017887971 XP_017887970 XP_017887969 XP_017887968 |
156304 |
| Ceratosolen solmsi marchali | Ceratosolen solmsi marchali | XP_011499537 |
326594 |
| Chelonia mydas | Green sea turtle | EMP31019 XP_007064965 |
8469 |
| Chrysemys picta bellii | Western painted turtle | XP_008173454 |
8478 |
| Cricetulus griseus | Chinese hamster | XP_007634408 XP_003514004 ERE65486 |
10029 |
| Cryptococcus gattii 2001/935-1 | Cryptococcus gattii 2001/935-1 | KIR99663 |
1334442 |
| Cryptococcus gattii CA1280 | Cryptococcus gattii ca1280 | KIR46118 |
1296109 |
| Cryptococcus gattii CA1873 | Cryptococcus gattii ca1873 | KIR58854 |
1296111 |
| Cryptococcus gattii CBS 10090 | Cryptococcus gattii cbs 10090 | KIR28991 |
1296101 |
| Cryptococcus gattii E566 | Cryptococcus gattii e566 | XP_003194436 |
1296102 |
| Cryptococcus gattii EJB2 | Cryptococcus gattii ejb2 | KIR78397 |
1296103 |
| Cryptococcus gattii LA55 | Cryptococcus gattii la55 | KIR28991 |
1296106 |
| Cryptococcus gattii MMRL2647 | Cryptococcus gattii mmrl2647 | KIR28991 |
1296117 |
| Cryptococcus gattii NT-10 | Cryptococcus gattii nt-10 | XP_003194436 |
1296108 |
| Cryptococcus gattii R265 | Cryptococcus gattii r265 | KIR73584 |
294750 |
| Cryptococcus gattii Ram5 | Cryptococcus gattii ram5 | KIR28991 |
1296110 |
| Cryptococcus gattii Ru294 | Cryptococcus gattii ru294 | KIR51594 |
1296112 |
| Cryptococcus gattii WM276 | Cryptococcus gattii wm276 | XP_003194436 |
367775 |
| Cryptococcus neoformans var. grubii H99 | Cryptococcus neoformans var. grubii h99 | XP_012049852 |
235443 |
| Cryptococcus neoformans var. neoformans B-3501A | Cryptococcus neoformans var. neoformans b-3501a | XP_775153 |
283643 |
| Cryptococcus neoformans var. neoformans JEC21 | Cryptococcus neoformans var. neoformans jec21 | XP_571081 |
214684 |
| Diachasma alloeum | Diachasma alloeum | XP_015112237 |
454923 |
| Dufourea novaeangliae | Dufourea novaeangliae | KZC04597 XP_015435275 |
178035 |
| Emiliania huxleyi CCMP1516 | Emiliania huxleyi ccmp1516 | XP_005756339 |
280463 |
| Eufriesea mexicana | Eufriesea mexicana | OAD61285 XP_017766289 XP_017766287 |
516756 |
| Exophiala spinifera | Exophiala spinifera | XP_016233715 |
91928 |
| Habropoda laboriosa | Habropoda laboriosa | XP_017793188 KOC62392 |
597456 |
| Homo sapiens | Human | AAH32889 |
9606 |
| Klebsormidium flaccidum | Klebsormidium flaccidum | GAQ87148 |
3175 |
| Lasius niger | Lasius niger | KMR00226 |
67767 |
| Leucoagaricus sp. SymC.cos | Leucoagaricus sp. symc.cos | KXN82957 |
1714833 |
| Megachile rotundata | Alfalfa leafcutting bee | XP_012146508 XP_012146507 XP_012146506 XP_003705776 XP_012146504 |
143995 |
| Melipona quadrifasciata | Melipona quadrifasciata | KOX76343 |
166423 |
| Metarhizium anisopliae BRIP 53284 | Metarhizium anisopliae brip 53284 | KJK77171 |
1291519 |
| Metarhizium anisopliae BRIP 53293 | Metarhizium anisopliae brip 53293 | KJK77171 |
1291518 |
| Metarhizium robertsii | Metarhizium robertsii | EXU97888 |
568076 |
| Meyerozyma guilliermondii ATCC 6260 | Meyerozyma guilliermondii atcc 6260 | XP_001484261 |
294746 |
| Microtus ochrogaster | Prairie vole | XP_005365993 |
79684 |
| Nematostella vectensis | Starlet sea anemone | XP_001629445 XP_001633955 |
45351 |
| Neodiprion lecontei | Redheaded pine sawfly | XP_015514874 XP_015514872 |
441921 |
| Nicotiana sylvestris | Wood tobacco | XP_009797053 XP_009797052 XP_009764784 XP_009757911 XP_009757912 |
4096 |
| Nicotiana tabacum | Common tobacco | XP_016445760 XP_009797052 XP_009764784 Q03461 XP_009757911 |
4097 |
| Ochroconis gallopava | Ochroconis gallopava | XP_016215044 |
253628 |
| Paraphaeosphaeria sporulosa | Paraphaeosphaeria sporulosa | XP_018036403 |
1460663 |
| Peromyscus maniculatus bairdii | Prairie deer mouse | XP_006985650 |
230844 |
| Phaeosphaeria nodorum SN15 | Phaeosphaeria nodorum sn15 | XP_001792876 |
321614 |
| Physcomitrella patens | Physcomitrella patens | XP_001775588 |
3218 |
| Phytophthora sojae | Phytophthora sojae | XP_009535888 |
67593 |
| Solanum lycopersicum | Tomato | CEO90884 NP_001233953 NP_001316314 |
4081 |
| Solanum pennellii | Solanum pennellii | XP_015055130 XP_015089178 |
28526 |
| Solanum tuberosum | Potato | ABU49732 ABU49731 ABU49730 NP_001275027 XP_006367395 XP_006367394 XP_006362360 XP_006355283 XP_006355280 XP_006355279 XP_006345269 AAM82606 AAM82607 XP_006362358 XP_006355281 |
4113 |
| Spathaspora passalidarum NRRL Y-27907 | Spathaspora passalidarum nrrl y-27907 | XP_007374774 |
619300 |
| Struthio camelus australis | Struthio camelus australis | KFV85730 |
441894 |
| Theobroma cacao | Cacao | EOY13401 EOY13402 EOY13400 |
3641 |
| Trypanosoma cruzi | Trypanosoma cruzi | XP_816580 XP_807965 |
5693 |
| Trypanosoma cruzi Dm28c | Trypanosoma cruzi dm28c | ESS63999 |
1416333 |
| Trypanosoma cruzi strain CL Brener | Trypanosoma cruzi strain cl brener | XP_816580 XP_807965 |
353153 |
| Vitis vinifera | Wine grape | XP_010648811 |
29760 |
| Zymoseptoria brevis | Zymoseptoria brevis | KJY01681 |
1047168 |
| fungal sp. No.11243 | Fungal sp. no.11243 | GAM85156 |
1603295 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.