If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GEEMEEMVQSAR
Peptide within the protein Jug-r-3:
AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARDLPNECGISSQRCEIRRSWF
References reporting this peptide:
- Heick J., et al. Application of a liquid chromatography tandem mass spectrometry method for the simultaneous detection of seven allergenic foods in flour and bread and comparison of the method with commercially available ELISA test kits.. Journal of AOAC International. 2011
- Planque, et al. Development of a strategy for the quantification of food allergens in several food products by mass spectrometry in a routine laboratory. Food Chemistry. 2019
- Planque, et al. Liquid chromatography coupled to tandem mass spectrometry for detecting ten allergens in complex and incurred foodstuffs. Journal of Chromatography A. 2017
- Sealey-Voyksner, et al. Discovery of highly conserved unique peanut and tree nut peptides by LC-MS/MS for multi-allergen detection.. Food chemistry. 2016
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Walnut | Jug-n-1.0101 | 16719 |
| Walnut | Jug-r-1.0101 | 51240 |
| Walnut | Jug-r-3.0101 | 51240 |
Species containing the peptide GEEMEEMVQSAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Juglans nigra | Black walnut | AAM54365 AAM54365 AAM54365 |
16719 |
| Juglans regia | English walnut | AAB41308 AAB41308 AAB41308 |
51240 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.