If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ELYETASELPR
Peptide within the protein Ana-o-3:
MAKFLLLLSAFAVLLLVANASIYRAIVEVEEDSGREQSCQRQFEEQQRFRNCQRYVKQEVQRGGRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASELPRICSISPSQGCQFQSSY
References reporting this peptide:
- Planque, et al. Development of a strategy for the quantification of food allergens in several food products by mass spectrometry in a routine laboratory. Food Chemistry. 2019
- Planque, et al. Liquid chromatography coupled to tandem mass spectrometry for detecting ten allergens in complex and incurred foodstuffs. Journal of Chromatography A. 2017
Species Uniqueness
Species containing the peptide ELYETASELPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Anacardium occidentale | Cashew | AAL91665 |
171929 |
| Pistacia vera | Pistacia vera | ABG73108 |
55513 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.