If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VLVLDTDYK
Peptide within the protein Bos-d-5:
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
References reporting this peptide:
- Figeys D., et al. Protein identification by capillary zone electrophoresis/microelectrospray ionization-tandem mass spectrometry at the subfemtomole level. Analytical Chemistry. 1996
- Lutter P., et al. Development and Validation of a Method for the Quantification of Milk Proteins in Food Products Based on Liquid Chromatography with Mass Spectrometric Detection. Journal of AOAC International. 2011
- Parker, et al. Multi-allergen Quantitation and the Impact of Thermal Treatment in Industry-Processed Baked Goods by ELISA and Liquid Chromatography-Tandem Mass Spectrometry.. Journal of Agricultural and Food Chemistry. 2015
- Planque M., et al. Advances in ultra-high performance liquid chromatography coupled to tandem mass spectrometry for sensitive detection of several food allergens in complex and processed foodstuffs. Journal of Chromatography A. 2016
- Planque, et al. Development of a strategy for the quantification of food allergens in several food products by mass spectrometry in a routine laboratory. Food Chemistry. 2019
- Planque, et al. Liquid chromatography coupled to tandem mass spectrometry for detecting ten allergens in complex and incurred foodstuffs. Journal of Chromatography A. 2017
Species Uniqueness
Species containing the peptide VLVLDTDYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bison bison bison | Bison | XP_010855058 |
43346 |
| Bos grunniens | Domestic yak | AFB74992 AFB74990 |
30521 |
| Bos indicus | Zebu (humped cattle) | AHJ80884 ADT82672 ADT82673 |
9915 |
| Bos mutus | Wild yak | XP_005888577 |
72004 |
| Bos taurus | Cattle | ALJ75589 ALJ75588 ADT82672 ADT82673 AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 732164A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
| Bubalus bubalis | Water buffalo | AAV65305 0601265A ABG78270 P02755 NP_001277893 |
89462 |
| Capra hircus | Goat | ACC44861 4TLJ_A ABQ51182 NP_001272468 |
9925 |
| Ovis aries | Sheep | CAA30059 4CK4_A 4NLI_A 4CK4_B NP_001009366 |
9940 |
| Ovis aries musimon | Mouflon | P67975 |
9938 |
| Ovis sp. | Sheep | AAA31510 |
9939 |
| Rangifer tarandus | Reindeer | 1YUP_A |
9870 |
| Rangifer tarandus tarandus | Reindeer | AAZ57420 |
86329 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.