If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VYVEELKPTPEGDLEILLQK
Peptide within the protein Bos-d-5:
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
References reporting this peptide:
- Figeys D., et al. Protein identification by capillary zone electrophoresis/microelectrospray ionization-tandem mass spectrometry at the subfemtomole level. Analytical Chemistry. 1996
- Montowska, et al. Detection of peptide markers of soy, milk and egg white allergenic proteins in poultry products by LC-Q-TOF-MS/MS. LWT - Food Science and Technology. 2018
- Planque M., et al. Advances in ultra-high performance liquid chromatography coupled to tandem mass spectrometry for sensitive detection of several food allergens in complex and processed foodstuffs. Journal of Chromatography A. 2016
- Planque, et al. Liquid chromatography coupled to tandem mass spectrometry for detecting ten allergens in complex and incurred foodstuffs. Journal of Chromatography A. 2017
Species Uniqueness
Species containing the peptide VYVEELKPTPEGDLEILLQK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bison bison bison | Bison | XP_010855238 |
43346 |
| Bos grunniens | Domestic yak | AFB74992 AFB74990 |
30521 |
| Bos mutus | Wild yak | ELR61650 XP_014336945 XP_005888596 XP_005888577 |
72004 |
| Bos taurus | Cattle | AAA30411 3PH5_A 5HTD_A 1UZ2_X 1BSQ_A 732164A 1DV9_A 1BSO_A 1BEB_A 5K06_A NP_776354 ACG59280 CAA32835 XP_015329083 |
9913 |
| Bubalus bubalis | Water buffalo | 0601265A ABG78270 P02755 NP_001277893 XP_006062280 |
89462 |
| Capra hircus | Goat | XP_017910230 |
9925 |
| Pantholops hodgsonii | Chiru | XP_005963296 |
59538 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.