Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: FGDTAAGTNR
Peptide within the protein Ara-h-10:
MTDRTQPHTVQVHTTAGRFGDTAAGTNRYPDRGPSTSKVIAVITGLPIGGTLLLFAGLALAGTLLGLAVTTPLFILFSPVIVPAIIVVGLSVAGFLTSGACGLTGLSSFSWVMNYIRQTHGSVPEQLEMAKHRMADVAGYVGQKTKDVGQKTKEVGQEIQTKAQDSKRT
MTDRTQPHAVQVHTTAGRFGDTAAGTNRYADRGPSTSKVIAVITGLPIGGTLLLFAGLALAGTLLGLAVTTPLFILFSPVIVPATIVVGLSVAGFLTSGACGLTGLSSFSWVMNYIRQTHGSVPEQLEMAKHRMADVAGYVGQKTKDVGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide FGDTAAGTNR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis duranensis | Peanut ancestor | XP_015971604 XP_015971604 |
130453 |
| Arachis hypogaea | Peanut | AAU21500 XP_015971604 AAU21500 XP_015971604 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016162337 XP_016162337 |
130454 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.