Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: CCNELNEFENNQR
Peptide within the protein Ara-h-2:
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
References reporting this peptide:
- Careri M., et al. Use of specific peptide biomarkers for quantitative confirmation of hidden allergenic peanut proteins Ara h 2 and Ara h 3/4 for food control by liquid chromatography–tandem mass spectrometry. Analytical and Bioanalytical Chemistry. 2007
- Careri M., et al. Determination of peanut allergens in cereal-chocolate-based snacks: metal-tag inductively coupled plasma mass spectrometry immunoassay versus liquid chromatography/electrospray ionization tandem mass spectrometry. Rapid Communications in Mass Spectrometry. 2008
- Hebling C.M., et al. Global Proteomic Screening of Protein Allergens and Advanced Glycation Endproducts in Thermally Processed Peanuts. Journal of Agricultural and Food Chemistry. 2013
- Hebling C.M., et al. Size-Selective Fractionation and Visual Mapping of Allergen Protein Chemistry in Arachis hypogaea. Journal of Proteome Research. 2012
- Parker, et al. Multi-allergen Quantitation and the Impact of Thermal Treatment in Industry-Processed Baked Goods by ELISA and Liquid Chromatography-Tandem Mass Spectrometry.. Journal of Agricultural and Food Chemistry. 2015
- Pedreschi R., et al. Current Challenges in Detecting Food Allergens by Shotgun and Targeted Proteomic Approaches: A Case Study on Traces of Peanut Allergens in Baked Cookies. Nutrients. 2012
- Sayers, et al. Microfluidic separation coupled to mass spectrometry for quantification of peanut allergens in a complex food matrix. Journal of Proteome Research. 2017
Species Uniqueness
Species containing the peptide CCNELNEFENNQR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis duranensis | Peanut ancestor | XP_015936509 ABW36075 ABW36073 ABW36072 ABW36069 XP_015936509 ABW36075 ABW36073 ABW36072 ABW36069 |
130453 |
| Arachis hypogaea | Peanut | AAK96887 ACN62248 ABL14268 AAO61750 AAM78596 XP_016170466 AAT00599 AAU21494 AAT00598 AAK96887 ACN62248 ABL14268 AAO61750 AAM78596 XP_016170466 AAT00599 AAU21494 AAT00598 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016170467 XP_016170466 XP_016170467 XP_016170466 |
130454 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.