Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: CDLEVESGGR
Peptide within the protein Ara-h-2:
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
References reporting this peptide:
- Hebling C.M., et al. Size-Selective Fractionation and Visual Mapping of Allergen Protein Chemistry in Arachis hypogaea. Journal of Proteome Research. 2012
- Pedreschi R., et al. Current Challenges in Detecting Food Allergens by Shotgun and Targeted Proteomic Approaches: A Case Study on Traces of Peanut Allergens in Baked Cookies. Nutrients. 2012
Species Uniqueness
Species containing the peptide CDLEVESGGR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis hypogaea | Peanut | ABL14268 AAM78596 XP_016170466 AAT00598 ABL14268 AAM78596 XP_016170466 AAT00598 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016170467 XP_016170466 XP_016170467 XP_016170466 |
130454 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.