Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: CQSQLER
Peptide within the protein Ara-h-2:
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
References reporting this peptide:
- Apostolovic D., et al. Reduction and alkylation of peanut allergen isoforms Ara h 2 and Ara h 6; characterization of intermediate- and end products. Biochimica et Biophysica Acta (BBA) - Proteins and Proteomics. 2013
- Hebling C.M., et al. Size-Selective Fractionation and Visual Mapping of Allergen Protein Chemistry in Arachis hypogaea. Journal of Proteome Research. 2012
Species Uniqueness
Species containing the peptide CQSQLER are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis duranensis | Peanut ancestor | XP_015936509 ABW36075 ABW36073 ABW36072 ABW36069 XP_015936509 ABW36075 ABW36073 ABW36072 ABW36069 |
130453 |
| Arachis hypogaea | Peanut | AAK96887 ACN62248 ABL14268 AAO61750 AAM78596 XP_016170466 AAT00599 AAU21494 AAT00598 AAK96887 ACN62248 ABL14268 AAO61750 AAM78596 XP_016170466 AAT00599 AAU21494 AAT00598 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016170467 XP_016170466 XP_016170467 XP_016170466 |
130454 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.