Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DEDSYGR
Peptide within the protein Ara-h-2:
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
References reporting this peptide:
- Hebling C.M., et al. Size-Selective Fractionation and Visual Mapping of Allergen Protein Chemistry in Arachis hypogaea. Journal of Proteome Research. 2012
Species Uniqueness
Species containing the peptide DEDSYGR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis hypogaea | Peanut | ABL14268 AAO61750 AAM78596 XP_016170466 AAT00598 ABL14268 AAO61750 AAM78596 XP_016170466 AAT00598 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016170467 XP_016170466 XP_016170467 XP_016170466 |
130454 |
| Aureobasidium pullulans var. namibiae CBS 147.97 | Aureobasidium pullulans var. namibiae cbs 147.97 | XP_013426352 XP_013426352 |
1043004 |
| Biomphalaria glabrata | Biomphalaria glabrata | XP_013071834 XP_013071834 |
6526 |
| Coffea canephora | Coffea canephora | CDP08502 CDP08502 |
49390 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | KZN03877 XP_017238139 KZN03877 XP_017238139 |
79200 |
| Micromonas pusilla CCMP1545 | Micromonas pusilla ccmp1545 | XP_003062349 XP_003062349 |
564608 |
| Notothenia coriiceps | Black rockcod | XP_010776992 XP_010776924 XP_010776992 XP_010776924 |
8208 |
| Pisolithus tinctorius Marx 270 | Pisolithus tinctorius marx 270 | KIO02835 KIO02835 |
870435 |
| Pseudogymnoascus pannorum VKM F-4246 | Pseudogymnoascus pannorum vkm f-4246 | KFY16185 KFY16185 |
1420902 |
| Pseudogymnoascus pannorum VKM F-4513 (FW-928) | Pseudogymnoascus pannorum vkm f-4513 (fw-928) | KFY44758 KFY44758 |
1420907 |
| Yarrowia lipolytica CLIB122 | Yarrowia lipolytica clib122 | XP_505739 XP_505739 |
284591 |
| uncultured marine group II/III euryarchaeote KM3_15_H06 | Uncultured marine group ii/iii euryarchaeote km3_15_h06 | AIF02964 AIF02964 |
1457911 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.