Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QQEQQFK
Peptide within the protein Ara-h-2:
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
MAKLTILVALALFLLAAHASARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
References reporting this peptide:
- Hebling C.M., et al. Size-Selective Fractionation and Visual Mapping of Allergen Protein Chemistry in Arachis hypogaea. Journal of Proteome Research. 2012
Species Uniqueness
Species containing the peptide QQEQQFK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis duranensis | Peanut ancestor | XP_015936509 ABW36075 ABW36073 ABW36072 ABW36069 XP_015936509 ABW36075 ABW36073 ABW36072 ABW36069 |
130453 |
| Arachis hypogaea | Peanut | AAK96887 ACN62248 ABL14268 AAO61750 AAM78596 XP_016170466 AAT00599 AAU21494 AAT00598 AAK96887 ACN62248 ABL14268 AAO61750 AAM78596 XP_016170466 AAT00599 AAU21494 AAT00598 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016170467 XP_016170466 XP_016170467 XP_016170466 |
130454 |
| Choanephora infundibulifera f. cucurbitarum | Choanephora infundibulifera f. cucurbitarum | OBZ83774 OBZ83774 |
101091 |
| Cladophialophora bantiana CBS 173.52 | Cladophialophora bantiana cbs 173.52 | XP_016616071 XP_016616071 |
1442370 |
| Cladophialophora psammophila CBS 110553 | Cladophialophora psammophila cbs 110553 | XP_007742235 XP_007742235 |
1182543 |
| Cryptococcus pinus CBS 10737 | Cryptococcus pinus cbs 10737 | OCF50257 OCF50257 |
1296096 |
| Cuerna arida | Cuerna arida | JAS38214 JAS38214 |
1464854 |
| Fonsecaea erecta | Fonsecaea erecta | OAP65423 OAP65423 |
1367422 |
| Fonsecaea monophora | Fonsecaea monophora | OAG36127 OAG36127 |
254056 |
| Fonsecaea multimorphosa | Fonsecaea multimorphosa | OAL30402 OAL30402 |
979981 |
| Fonsecaea multimorphosa CBS 102226 | Fonsecaea multimorphosa cbs 102226 | XP_016637280 XP_016637280 |
1442371 |
| Fonsecaea nubica | Fonsecaea nubica | OAG36127 OAG36127 |
856822 |
| Fonsecaea pedrosoi CBS 271.37 | Fonsecaea pedrosoi cbs 271.37 | XP_013279108 XP_013279108 |
1442368 |
| Fragaria vesca subsp. vesca | Fragaria vesca subsp. vesca | XP_004304997 XP_004304997 |
101020 |
| Graphocephala atropunctata | Graphocephala atropunctata | JAT18042 JAT14446 JAT17604 JAT18042 JAT14446 JAT17604 |
36148 |
| Homalodisca liturata | Homalodisca liturata | JAS79155 JAS84071 JAS79155 JAS84071 |
320908 |
| Musca domestica | House fly | XP_005177266 XP_005177266 |
7370 |
| Pachysolen tannophilus NRRL Y-2460 | Pachysolen tannophilus nrrl y-2460 | ODV95221 ODV94179 ODV95221 ODV94179 |
669874 |
| Paramecium tetraurelia | Paramecium tetraurelia | XP_001449235 XP_001449235 |
5888 |
| Paramecium tetraurelia strain d4-2 | Paramecium tetraurelia strain d4-2 | XP_001449235 XP_001449235 |
412030 |
| Pseudocohnilembus persalinus | Pseudocohnilembus persalinus | KRX09471 KRX11227 KRX09471 KRX11227 |
266149 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.