Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peanut Protein: Ara h 7 | Conglutin (2S Albumin)
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 160 amino acids
MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHMRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQILQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL
UniProt: Q9SQH1 IUIS: Ara h 7Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| K | LSILVALLGALLVVASATR | W | 0 | 0.352 | 0.23412 |
| R | GDDQCQR | Q | 0 | 0.227 | 0.07198 |
| R | ANLRPCEEHMR | R | 0 | 0.243 | 0.21602 |
| R | VEQEQEQEQDEYPYSR | R | 0 | 0.536 | 0.3499 |
| R | QPGESDENQEQR | C | 0 | 0.321 | 0.18708 |
| R | VQVTKPLRPL | $ | 0 | 0.322 | 0.47464 |
| R | ANLRPCEEHIR | Q | 0 | 0.228 | 0.28162 |
| K | EQEQEQDEYPYIQR | G | 0 | 0.558 | 0.33382 |
| R | GQRPGESDEDQEQR | C | 0 | 0.243 | 0.15498 |
| R | CMCQALQQILQNQSFR | F | 0 | 0.387 | 0.20546 |
| R | SQLHQMER | E | 0 | 0.21 | 0.17174 |
| R | NLPQNCGFR | S | 2 | 0.439 | 0.39568 |
| R | CCNELNR | F | 1 | 0.306 | 0.17444 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.