Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NLPQNCGFR
Peptide within the protein Ara-h-7:
MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHMRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQILQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL
MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHIRQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQILQNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDLSSRTPY
References reporting this peptide:
- Beverly, et al. Assessment of Peanut Allergen Cross-Contact Risk from Reused Roasting Oil Using a Targeted Proteomics Method. Journal of Agricultural and Food Chemistry. 2026
- Sayers, et al. Microfluidic separation coupled to mass spectrometry for quantification of peanut allergens in a complex food matrix. Journal of Proteome Research. 2017
Species Uniqueness
Species containing the peptide NLPQNCGFR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis hypogaea | Peanut | ABW17159 |
3818 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.